PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29629.m001382
Common NameLOC8286837, RCOM_0522070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NF-YB
Protein Properties Length: 180aa    MW: 19391.4 Da    PI: 4.8897
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29629.m001382genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.96.3e-5827122297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++relegek
  29629.m001382  27 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFRELEGEK 122
                    79********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.2E-5425130IPR009072Histone-fold
SuperFamilySSF471132.95E-4029130IPR009072Histone-fold
PfamPF008085.4E-283296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.2E-216078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.2E-217997No hitNo description
PRINTSPR006155.2E-2198116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MADSDNDSGG TQNPANASNN SDFLSPKEQD RFLPIANVSR IMKKALPANA KISKDAKETV  60
QECVSEFISF VTGEASDKCQ REKRKTINGD DLLWAMTTLG FEEYVEPLKV YLQRFRELEG  120
EKNAAVREKD APGNGGGFGF DGYGGYQGHV YGSSGGFFNQ MGGSGGPEYG GPGTSLGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-4724117194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4724117194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B3e-4727117292Transcription factor HapC (Eurofung)
4g92_B3e-4727117292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577020.11e-131PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233102e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB9S9T31e-131B9S9T3_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0001s37620.14e-86(Populus trichocarpa)
STRINGGLYMA18G08620.17e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-73nuclear factor Y, subunit B3